PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID GSBRNA2T00043005001
Common NameGSBRNA2T00043005001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family TALE
Protein Properties Length: 390aa    MW: 44766.8 Da    PI: 6.6497
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
GSBRNA2T00043005001genomeGenoscopeView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox31.52.9e-102372741954
                          HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
             Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                          Fe   ++yp+++e+  LAk++gL+++qV +WF N R +
  GSBRNA2T00043005001 237 FEHflHPYPKESEKMMLAKQTGLSKNQVANWFINARVR 274
                          664459******************************88 PP

2BELL115.82.2e-3793164172
                 BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                          erqelq+kk+kLl++++eVdkrY+qy++q+++++ssFe+vag gsakpYtslAl++iS +Fr+L+dai+eqi
  GSBRNA2T00043005001  93 ERQELQNKKNKLLTMVDEVDKRYNQYYHQMEALASSFEIVAGFGSAKPYTSLALNKISCSFRSLRDAIKEQI 164
                          79*********************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005742.0E-4827162IPR006563POX domain
PfamPF075261.5E-4534160IPR006563POX domain
PROSITE profilePS5007112.6215278IPR001356Homeobox domain
CDDcd000862.07E-10218279No hitNo description
SMARTSM003892.0E-9218282IPR001356Homeobox domain
SuperFamilySSF466892.82E-17219283IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-27221282IPR009057Homeodomain-like
PfamPF059206.0E-18235274IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 390 aa     Download sequence    Send to blast
MLLLGQSNPS SGYAGLYSNY RFNETSGGFM SSFLRSRYLK PAQNLLDEVV SVKKELNQMR  60
KKKQKGEEDF NNGSKDTQGE LSTDSNVKLS TIERQELQNK KNKLLTMVDE VDKRYNQYYH  120
QMEALASSFE IVAGFGSAKP YTSLALNKIS CSFRSLRDAI KEQIQIIREK LGEKGGGGES  180
LDEQQGGGER IPRLRYLDQR LRQQRAFHQQ LGMVRPSWRP QRGLPENSVS VLRAWLFEHF  240
LHPYPKESEK MMLAKQTGLS KNQVANWFIN ARVRLWKPMI EDIYKEEFGD ESELQISKSS  300
QELNSTNQDD SSSQQQQGDN NNNLGYPSAD TTNINDKPQQ EQEMNRSGDY ETLMNYQGFG  360
LEEEYRYMGG NNQEDSRFSN AHHLHDFVV*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_B3e-16224281562Homeobox protein Meis2
3k2a_A3e-16224281562Homeobox protein Meis2
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Bna.200690.0leaf
Cis-element ? help Back to Top
SourceLink
PlantRegMapGSBRNA2T00043005001
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013641869.10.0PREDICTED: BEL1-like homeodomain protein 10
SwissprotQ9FXG80.0BLH10_ARATH; BEL1-like homeodomain protein 10
TrEMBLA0A078GV590.0A0A078GV59_BRANA; BnaA06g13850D protein
STRINGBra025758.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM38201959
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19700.30.0BEL1-like homeodomain 10
Publications ? help Back to Top
  1. Chalhoub B, et al.
    Plant genetics. Early allopolyploid evolution in the post-Neolithic Brassica napus oilseed genome.
    Science, 2014. 345(6199): p. 950-3
    [PMID:25146293]